SCOPe 2.08: Domain d2ndpb_: 2ndp B:

Lineage for d2ndpb_ (2ndp B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Mycoplasma gallisepticum [TaxId:1006581] [346180] (1 PDB entry)

8. Domain d2ndpb_: 2ndp B: [344618]
   automated match to d5ekaa_

Details for d2ndpb_

PDB Entry: 2ndp

PDB Description: structure of dna-binding hu protein from micoplasma mycoplasma gallisepticum

PDB Compounds: (B:) Histone-like DNA-binding superfamily protein

SCOPe Domain Sequences for d2ndpb_:

Sequence; same for both SEQRES and ATOM records:

>d2ndpb_ a.55.1.0 (B:) automated matches {Mycoplasma gallisepticum [TaxId: 1006581]}
makikslsaaeylkemadetnikvqdirlvvtslqkvlakelattgevrlfdigkfklvt
tkprtginpktkqkiqipagkkikltvskiltdavdshk

Timeline for d2ndpb_:

• d2ndpb_ first appeared in SCOPe 2.07