Lineage for d2ndpa_ (2ndp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323998Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2323999Protein automated matches [191007] (9 species)
    not a true protein
  7. 2324018Species Mycoplasma gallisepticum [TaxId:1006581] [346180] (1 PDB entry)
  8. 2324019Domain d2ndpa_: 2ndp A: [344617]
    automated match to d5ekaa_

Details for d2ndpa_

PDB Entry: 2ndp (more details)

PDB Description: structure of dna-binding hu protein from micoplasma mycoplasma gallisepticum
PDB Compounds: (A:) Histone-like DNA-binding superfamily protein

SCOPe Domain Sequences for d2ndpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ndpa_ a.55.1.0 (A:) automated matches {Mycoplasma gallisepticum [TaxId: 1006581]}
makikslsaaeylkemadetnikvqdirlvvtslqkvlakelattgevrlfdigkfklvt
tkprtginpktkqkiqipagkkikltvskiltdavdshk

SCOPe Domain Coordinates for d2ndpa_:

Click to download the PDB-style file with coordinates for d2ndpa_.
(The format of our PDB-style files is described here.)

Timeline for d2ndpa_:

  • d2ndpa_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d2ndpb_