SCOPe 2.08: Domain d2mzha1: 2mzh A:0-72

Lineage for d2mzha1 (2mzh A:0-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (3 families)

5. Family a.20.1.0: automated matches [336862] (1 protein)
   not a true family

6. Protein automated matches [336863] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [336864] (5 PDB entries)

8. Domain d2mzha1: 2mzh A:0-72 [344611]
   Other proteins in same PDB: d2mzha2
   automated match to d5ue5a1
   complexed with ca, px4, zn

Details for d2mzha1

PDB Entry: 2mzh

PDB Description: nmr solution structure of the pro form of human matrilysin (prommp-7) in complex with zwitterionic membrane

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2mzha1:

Sequence; same for both SEQRES and ATOM records:

>d2mzha1 a.20.1.0 (A:0-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvi
eimqkprcgvpdv

Timeline for d2mzha1:

• d2mzha1 first appeared in SCOPe 2.07