Lineage for d2mzea2 (2mze A:73-247)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.0: automated matches [191495] (1 protein)
not a true familyProtein automated matches [190805] (20 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) 
Domain d2mzea2: 2mze A:73-247 [344610]
Other proteins in same PDB: d2mzea1
automated match to d5ue5a2
complexed with ca, zn
Details for d2mzea2
PDB Entry: 2mze (more details)
PDB Description: nmr solution structure of the pro form of human matrilysin (prommp-7)
PDB Compounds: (A:) MatrilysinSCOPe Domain Sequences for d2mzea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mzea2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta
dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa
thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk
SCOPe Domain Coordinates for d2mzea2:
Click to download the PDB-style file with coordinates for d2mzea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mzea2:
- d2mzea2 first appeared in SCOPe 2.07
View in 3D
