![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries) |
![]() | Domain d2m5ga_: 2m5g A: [344604] automated match to d5lp9a_ |
PDB Entry: 2m5g (more details)
SCOPe Domain Sequences for d2m5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m5ga_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
Timeline for d2m5ga_: