Lineage for d2m5ga_ (2m5g A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767888Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)
  8. 2767904Domain d2m5ga_: 2m5g A: [344604]
    automated match to d5lp9a_

Details for d2m5ga_

PDB Entry: 2m5g (more details)

PDB Description: solution structure of fima wt
PDB Compounds: (A:) Type-1 fimbrial protein, A chain

SCOPe Domain Sequences for d2m5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m5ga_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
ettlnngtntipfqaryfatgaatpgaanadatfkvqyq

SCOPe Domain Coordinates for d2m5ga_:

Click to download the PDB-style file with coordinates for d2m5ga_.
(The format of our PDB-style files is described here.)

Timeline for d2m5ga_: