Lineage for d2kbyc_ (2kby C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323790Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2323791Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2323852Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2323853Protein automated matches [259190] (2 species)
    not a true protein
  7. 2323854Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2323882Domain d2kbyc_: 2kby C: [344601]
    automated match to d5hobg_

Details for d2kbyc_

PDB Entry: 2kby (more details)

PDB Description: The Tetramerization Domain of Human p73
PDB Compounds: (C:) Tumor protein p73

SCOPe Domain Sequences for d2kbyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kbyc_ a.53.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

SCOPe Domain Coordinates for d2kbyc_:

Click to download the PDB-style file with coordinates for d2kbyc_.
(The format of our PDB-style files is described here.)

Timeline for d2kbyc_:

  • d2kbyc_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d2kbyd_