Lineage for d2ip4b3 (2ip4 B:319-414)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406232Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2406335Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2406460Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2406461Protein automated matches [254496] (14 species)
    not a true protein
  7. 2406512Species Thermus thermophilus [TaxId:300852] [346267] (1 PDB entry)
  8. 2406514Domain d2ip4b3: 2ip4 B:319-414 [344592]
    Other proteins in same PDB: d2ip4a1, d2ip4a2, d2ip4b1, d2ip4b2
    automated match to d5veva3
    complexed with so4

Details for d2ip4b3

PDB Entry: 2ip4 (more details), 2.8 Å

PDB Description: Crystal Structure of Glycinamide Ribonucleotide Synthetase from Thermus thermophilus HB8
PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2ip4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ip4b3 b.84.2.0 (B:319-414) automated matches {Thermus thermophilus [TaxId: 300852]}
egaaacvvlaapgypesprkgiplhvpeppegvlvfhagtrreggrlvsaggrvlnvvgl
grdlkealerayayipqvgfpgavyrrdigrralar

SCOPe Domain Coordinates for d2ip4b3:

Click to download the PDB-style file with coordinates for d2ip4b3.
(The format of our PDB-style files is described here.)

Timeline for d2ip4b3:

  • d2ip4b3 is new in SCOPe 2.07-stable