Lineage for d2illa2 (2ill A:101-195)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2355798Domain d2illa2: 2ill A:101-195 [344586]
    automated match to d2dm3a1
    complexed with cl

Details for d2illa2

PDB Entry: 2ill (more details), 2.2 Å

PDB Description: Anomalous substructure of Titin-A168169
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2illa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2illa2 b.1.1.0 (A:101-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlpktlegmgavhalrgevvsikipfsgkpdpvitwqkgqdlidnnghyqvivtrsftsl
vfpngverkdagfyvvcaknrfgidqktveldvad

SCOPe Domain Coordinates for d2illa2:

Click to download the PDB-style file with coordinates for d2illa2.
(The format of our PDB-style files is described here.)

Timeline for d2illa2:

  • d2illa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2illa1