Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.4: Upf1 barrel domain-like [345920] (1 family) barrel topology is 125436 |
Family b.49.4.1: Upf1 barrel domain-like [345963] (2 proteins) |
Protein Upf1 barrel domain [346055] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [346248] (3 PDB entries) |
Domain d2gk7a2: 2gk7 A:325-415 [344582] Other proteins in same PDB: d2gk7a1, d2gk7a3 automated match to d2gjka3 complexed with po4 |
PDB Entry: 2gk7 (more details), 2.8 Å
SCOPe Domain Sequences for d2gk7a2:
Sequence, based on SEQRES records: (download)
>d2gk7a2 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]} tqdnitvrwdlglnkkriayftlpktdsdmrlmqgdeiclrykgdlaplwkgighvikvp dnygdeiaielrssvgapvevthnfqvdfvw
>d2gk7a2 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]} tqdnitvrwdlgkkriayftlpktdsdmrlmqgdeiclrywkgighvikvpdnygdeiai elrssvgthnfqvdfvw
Timeline for d2gk7a2: