Lineage for d2gk7a2 (2gk7 A:325-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2799116Superfamily b.49.4: Upf1 barrel domain-like [345920] (1 family) (S)
    barrel topology is 125436
  5. 2799117Family b.49.4.1: Upf1 barrel domain-like [345963] (2 proteins)
  6. 2799123Protein Upf1 barrel domain [346055] (1 species)
  7. 2799124Species Human (Homo sapiens) [TaxId:9606] [346248] (3 PDB entries)
  8. 2799128Domain d2gk7a2: 2gk7 A:325-415 [344582]
    Other proteins in same PDB: d2gk7a1, d2gk7a3
    automated match to d2gjka3
    complexed with po4

Details for d2gk7a2

PDB Entry: 2gk7 (more details), 2.8 Å

PDB Description: Structural and Functional insights into the human Upf1 helicase core
PDB Compounds: (A:) Regulator of nonsense transcripts 1

SCOPe Domain Sequences for d2gk7a2:

Sequence, based on SEQRES records: (download)

>d2gk7a2 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]}
tqdnitvrwdlglnkkriayftlpktdsdmrlmqgdeiclrykgdlaplwkgighvikvp
dnygdeiaielrssvgapvevthnfqvdfvw

Sequence, based on observed residues (ATOM records): (download)

>d2gk7a2 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]}
tqdnitvrwdlgkkriayftlpktdsdmrlmqgdeiclrywkgighvikvpdnygdeiai
elrssvgthnfqvdfvw

SCOPe Domain Coordinates for d2gk7a2:

Click to download the PDB-style file with coordinates for d2gk7a2.
(The format of our PDB-style files is described here.)

Timeline for d2gk7a2: