Lineage for d2gk6b3 (2gk6 B:703-911)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870927Protein Upf1, C-terminal domain [419079] (1 species)
  7. 2870928Species Human (Homo sapiens) [TaxId:9606] [419571] (3 PDB entries)
  8. 2870930Domain d2gk6b3: 2gk6 B:703-911 [344579]
    Other proteins in same PDB: d2gk6a1, d2gk6a2, d2gk6a4, d2gk6b1, d2gk6b2, d2gk6b4
    automated match to d2gjka2
    complexed with adp, mg, po4

Details for d2gk6b3

PDB Entry: 2gk6 (more details), 2.4 Å

PDB Description: Structural and Functional insights into the human Upf1 helicase core
PDB Compounds: (B:) Regulator of nonsense transcripts 1

SCOPe Domain Sequences for d2gk6b3:

Sequence, based on SEQRES records: (download)

>d2gk6b3 c.37.1.19 (B:703-911) Upf1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rmhpalsafpsnifyegslqngvtaadrvkkgfdfqwpqpdkpmffyvtqgqeeiassgt
sylnrteaanvekittkllkagakpdqigiitpyegqrsylvqymqfsgslhtklyqeve
iasvdafqgrekdfiilscvranehqgigflndprrlnvaltrarygviivgnpkalskq
plwnhllnyykeqkvlvegplnnlreslm

Sequence, based on observed residues (ATOM records): (download)

>d2gk6b3 c.37.1.19 (B:703-911) Upf1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rmhpalsafpsnifyegslqngvtaadrvkkgfdfqwpqpdkpmffyvtqgqeeiassgt
sylnrteaanvekittkllkagakpdqigiitpyegqrsylvqymqfsgslhtklyqeve
iasvdafqgrekdfiilscvrigflndprrlnvaltrarygviivgnpkalskqplwnhl
lnyykeqkvlvegplnnlreslm

SCOPe Domain Coordinates for d2gk6b3:

Click to download the PDB-style file with coordinates for d2gk6b3.
(The format of our PDB-style files is described here.)

Timeline for d2gk6b3: