Lineage for d2f3oa_ (2f3o A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434269Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2434270Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2434363Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2434364Protein automated matches [275324] (3 species)
    not a true protein
  7. 2434365Species Archaeoglobus fulgidus [TaxId:2234] [346280] (1 PDB entry)
  8. 2434366Domain d2f3oa_: 2f3o A: [344565]
    automated match to d5fayb_
    complexed with gol, pge

Details for d2f3oa_

PDB Entry: 2f3o (more details), 2.9 Å

PDB Description: Crystal Structure of a glycyl radical enzyme from Archaeoglobus fulgidus
PDB Compounds: (A:) pyruvate formate-lyase 2

SCOPe Domain Sequences for d2f3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3oa_ c.7.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
drieklikkvskparlsvercrlytesmkqtegepmiirqakalkhvlenipiqildsel
ivgtmlpnppgaiifpegvglriineldslpnretnrlmvdeedakvlreeiapywqrkt
ieafafplmpdimqilytgsvfvlteiagishvavnypyllrrgfrwfleeserrirale
esgvyegekysfyqaakivseavinyglrysklaeelaesedgerreellkiaeicrkvp
aekpetfweavqfvwlvqsalhqenyeqaismgridqylypffkkdigegrinrelafdi
lanlwiktneivpafdslleqyfsgqatnqavtiggcdiygndatneltylmlevtdrlr
lrqpnvhvrinkgspesflkrlaeaissgcnnlalffddaavkalknaevddrdalnytt
dgcveiapfgnsftssdaalinvakaleyalnegvdlqfgyefgaktekpkfledllekl
reqvshivklvvrgsnvlsyanaevkptpllslcvedcfekgvdvsrggarynftgiqav
giadvgdslvaiegalnagysmddiveacrknfvgyeklhklllqspkygndddaadkyt
kmvlewyceevnrhrnfrggkfaagcypmttnvgfgfftsalpsgrksgeplnpgvspst
gmdregvtavinsasklsyenlpngasltinlssdvlgekgdaviealikssmelgvmhv
qfnilkedllrkaqqepekyrwllvrvagwsayfvelsrpvqeevirriscri

SCOPe Domain Coordinates for d2f3oa_:

Click to download the PDB-style file with coordinates for d2f3oa_.
(The format of our PDB-style files is described here.)

Timeline for d2f3oa_:

  • d2f3oa_ is new in SCOPe 2.07-stable