Lineage for d2crha1 (2crh A:8-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572513Domain d2crha1: 2crh A:8-132 [344557]
    Other proteins in same PDB: d2crha2, d2crha3
    automated match to d2lnxa_

Details for d2crha1

PDB Entry: 2crh (more details)

PDB Description: solution structure of the sh2 domain of human proto-oncogene protein vav1
PDB Compounds: (A:) vav proto-oncogene

SCOPe Domain Sequences for d2crha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crha1 d.93.1.0 (A:8-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaeaeqnwwegppqdlsvhlwyagpmeragaesilanrsdgtflvrqrvkdaaefaisik
ynvevkhikimtaeglyritekkafrgltelvefyqqnslkdcfksldttlqfpfkepek
rtisr

SCOPe Domain Coordinates for d2crha1:

Click to download the PDB-style file with coordinates for d2crha1.
(The format of our PDB-style files is described here.)

Timeline for d2crha1: