Lineage for d2azqa_ (2azq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2380104Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2380105Protein automated matches [227026] (6 species)
    not a true protein
  7. 2380117Species Pseudomonas putida [TaxId:303] [346219] (1 PDB entry)
  8. 2380118Domain d2azqa_: 2azq A: [344550]
    automated match to d5umhb_
    complexed with fe, pcf

Details for d2azqa_

PDB Entry: 2azq (more details), 2.65 Å

PDB Description: crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d2azqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azqa_ b.3.6.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
vkishtadiqaffnqvagldhaegkprfkqiilrvlqdtarliedleitedefwhavdyl
nrlggrneagllaaglgiehfldllqdakdaeaglgggtprtiegplyvagaplaqgevr
mddgtdpgvvmflqgqvfdangkplagatvdlwhantqgtysyfdstqsefnlrrriitd
aegryrarsivpsgygcdpqgptqecldllgrhgqrpahvhffisafghrhlttqinfag
dkylwddfayatrdgligelrfvedaaaardrgvqgerfaelsfdfrlqgaqspdaears
hrpralqeg

SCOPe Domain Coordinates for d2azqa_:

Click to download the PDB-style file with coordinates for d2azqa_.
(The format of our PDB-style files is described here.)

Timeline for d2azqa_: