Lineage for d1z4za_ (1z4z A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein automated matches [193245] (21 species)
    not a true protein
  7. Species Simian virus 5 [TaxId:11207] [346257] (6 PDB entries)
  8. Domain d1z4za_: 1z4z A: [344548]
    automated match to d5b2da_
    complexed with ca, dan, nag

Details for d1z4za_

PDB Entry: 1z4z (more details), 2.5 Å

PDB Description: parainfluenza virus 5 (sv5) hemagglutinin-neuraminidase (hn) with ligand dana(soaked with sialic acid, ph7.0))
PDB Compounds: (A:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d1z4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4za_ b.68.1.1 (A:) automated matches {Simian virus 5 [TaxId: 11207]}
indnryinginqfyfsiaegrnltlgpllnmpsfiptattpegctripsfsltkthwcyt
hnvilngcqdhvssnqfvsmgiieptsagfpffrtlktlylsdgvnrkscsistvpggcm
mycfvstqperddyfsaappeqriiimyyndtiveriinppgvldvwatlnpgtgsgvyy
lgwvlfpiyggvikgtslwnnqankyfipqmvaalcsqnqatqvqnakssyysswfgnrm
iqsgilacplrqdltneclvlpfsndqvlmgaegrlymygdsvyyyqrsnswwpmtmlyk
vtitftngqpsaisaqnvptqqvprpgtgdcsatnrcpgfcltgvyadawlltnpsstst
fgseatftgsylntatqrinptmyianntqiissqqfgssgqeaayghttcfrdtgsvmv
yciyiielsssllgqfqivpfirqvtls

SCOPe Domain Coordinates for d1z4za_ are not available.

Timeline for d1z4za_: