Class b: All beta proteins [48724] (178 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein automated matches [190387] (4 species) not a true protein |
Species Morus nigra [TaxId:85232] [346263] (2 PDB entries) |
Domain d1xxrd_: 1xxr D: [344543] automated match to d5krpa_ complexed with acy, gol, man, so4 |
PDB Entry: 1xxr (more details), 2 Å
SCOPe Domain Sequences for d1xxrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxrd_ b.77.3.1 (D:) automated matches {Morus nigra [TaxId: 85232]} tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke egtpfslpienglivgfkgrsgfvvdaigfhlsl
Timeline for d1xxrd_: