Lineage for d1xxrd_ (1xxr D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422611Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2422723Protein automated matches [190387] (4 species)
    not a true protein
  7. 2422745Species Morus nigra [TaxId:85232] [346263] (2 PDB entries)
  8. 2422753Domain d1xxrd_: 1xxr D: [344543]
    automated match to d5krpa_
    complexed with acy, gol, man, so4

Details for d1xxrd_

PDB Entry: 1xxr (more details), 2 Å

PDB Description: structure of a mannose-specific jacalin-related lectin from morus nigra in complex with mannose
PDB Compounds: (D:) mannose-binding lectin

SCOPe Domain Sequences for d1xxrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxrd_ b.77.3.1 (D:) automated matches {Morus nigra [TaxId: 85232]}
tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
egtpfslpienglivgfkgrsgfvvdaigfhlsl

SCOPe Domain Coordinates for d1xxrd_:

Click to download the PDB-style file with coordinates for d1xxrd_.
(The format of our PDB-style files is described here.)

Timeline for d1xxrd_: