Lineage for d1xxrb_ (1xxr B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402564Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2402676Protein automated matches [190387] (4 species)
    not a true protein
  7. 2402698Species Morus nigra [TaxId:85232] [346263] (2 PDB entries)
  8. 2402704Domain d1xxrb_: 1xxr B: [344541]
    automated match to d5krpa_
    complexed with acy, gol, man, so4

Details for d1xxrb_

PDB Entry: 1xxr (more details), 2 Å

PDB Description: Structure of a mannose-specific jacalin-related lectin from Morus Nigra in complex with mannose
PDB Compounds: (B:) mannose-binding lectin

SCOPe Domain Sequences for d1xxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxrb_ b.77.3.1 (B:) automated matches {Morus nigra [TaxId: 85232]}
tqttgtsqtievglwggpggnawddgsytgireinlshgdaigafsviydlngqpftgpt
hpgnepsfktvkitldfpneflvsvsgytgvlarlatgkdvirsltfktnkktygpygke
egtpfslpienglivgfkgrsgfvvdaigfhlsl

SCOPe Domain Coordinates for d1xxrb_:

Click to download the PDB-style file with coordinates for d1xxrb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxrb_:

  • d1xxrb_ is new in SCOPe 2.07-stable