Lineage for d2oatc_ (2oat C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866757Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1866907Protein Ornithine aminotransferase [53422] (3 species)
  7. 1866908Species Human (Homo sapiens) [TaxId:9606] [53423] (6 PDB entries)
  8. 1866914Domain d2oatc_: 2oat C: [34454]
    complexed with pfm

Details for d2oatc_

PDB Entry: 2oat (more details), 1.95 Å

PDB Description: ornithine aminotransferase complexed with 5-fluoromethylornithine
PDB Compounds: (C:) ornithine aminotransferase

SCOPe Domain Sequences for d2oatc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oatc_ c.67.1.4 (C:) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssysavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d2oatc_:

Click to download the PDB-style file with coordinates for d2oatc_.
(The format of our PDB-style files is described here.)

Timeline for d2oatc_: