Lineage for d1wdha_ (1wdh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491481Family c.108.1.22: Enolase-phosphatase E1 [142186] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2491482Protein E-1 enzyme [142189] (1 species)
  7. 2491483Species Human (Homo sapiens) [TaxId:9606] [142190] (2 PDB entries)
    Uniprot Q9UHY7 4-256
  8. 2491484Domain d1wdha_: 1wdh A: [344534]
    automated match to d1zs9a1
    complexed with mg

Details for d1wdha_

PDB Entry: 1wdh (more details), 1.7 Å

PDB Description: Crystal Structure Of Human Enolase-phosphatase E1
PDB Compounds: (A:) E-1 enzyme

SCOPe Domain Sequences for d1wdha_:

Sequence, based on SEQRES records: (download)

>d1wdha_ c.108.1.22 (A:) E-1 enzyme {Human (Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft
agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk
ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek
tyyslitsfselyl

Sequence, based on observed residues (ATOM records): (download)

>d1wdha_ c.108.1.22 (A:) E-1 enzyme {Human (Homo sapiens) [TaxId: 9606]}
lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldkttalkqlqghmwraafta
grmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtki
ghkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddekt
yyslitsfselyl

SCOPe Domain Coordinates for d1wdha_:

Click to download the PDB-style file with coordinates for d1wdha_.
(The format of our PDB-style files is described here.)

Timeline for d1wdha_:

  • d1wdha_ is new in SCOPe 2.07-stable