Lineage for d1vbia_ (1vbi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922103Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2922104Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2922156Family c.122.1.0: automated matches [227150] (1 protein)
    not a true family
  6. 2922157Protein automated matches [226854] (8 species)
    not a true protein
  7. 2922179Species Thermus thermophilus [TaxId:274] [346343] (1 PDB entry)
  8. 2922180Domain d1vbia_: 1vbi A: [344532]
    automated match to d3i0pa_
    complexed with edo, nad, so4

Details for d1vbia_

PDB Entry: 1vbi (more details), 1.8 Å

PDB Description: Crystal structure of type 2 malate/lactate dehydrogenase from thermus thermophilus HB8
PDB Compounds: (A:) Type 2 malate/lactate dehydrogenase

SCOPe Domain Sequences for d1vbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbia_ c.122.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleagl
vnpsptlpleergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmag
lyaeklaregfvawvttnaepdvvpfggrekalgtnplafaapapqgilvadlatsesam
gkvflarekgerippswgvdregsptddphrvyalrplggpkgyalallvevlsgvltga
gvahgigrmydewdrpqdvghfllaldpgrfvgkeaflermgalwqalkatppapgheev
flpgelearrreralaegmalpervvaelkalgerygvpw

SCOPe Domain Coordinates for d1vbia_:

Click to download the PDB-style file with coordinates for d1vbia_.
(The format of our PDB-style files is described here.)

Timeline for d1vbia_: