SCOPe 2.07: Domain d1to7a1: 1to7 A:39-508

Lineage for d1to7a1 (1to7 A:39-508)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1to7a1: 1to7 A:39-508 [344523]
   Other proteins in same PDB: d1to7a2, d1to7b2
   automated match to d1u8ea1
   complexed with fuc, man, nag; mutant

Details for d1to7a1

PDB Entry: 1to7, 2.2 Å

PDB Description: Human Dipeptidyl Peptidase IV/CD26 Mutant Y547F

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1to7a1:

Sequence; same for both SEQRES and ATOM records:

>d1to7a1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d1to7a1:

• d1to7a1 is new in SCOPe 2.07-stable
  
• d1to7a1 appears in the current release, SCOPe 2.08