Lineage for d1tm8a_ (1tm8 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024310Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 3024349Protein automated matches [191175] (2 species)
    not a true protein
  7. 3024350Species Cow (Bos taurus) [TaxId:9913] [225041] (2 PDB entries)
  8. 3024351Domain d1tm8a_: 1tm8 A: [344522]
    automated match to d1ymga1
    complexed with bng

Details for d1tm8a_

PDB Entry: 1tm8 (more details), 2.24 Å

PDB Description: The Channel Architecture of Aquaporin O at 2.2 Angstrom Resolution
PDB Compounds: (A:) lens fiber major intrinsic protein

SCOPe Domain Sequences for d1tm8a_:

Sequence, based on SEQRES records: (download)

>d1tm8a_ f.19.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga
hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv
svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp
arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

Sequence, based on observed residues (ATOM records): (download)

>d1tm8a_ f.19.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah
vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs
vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa
rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

SCOPe Domain Coordinates for d1tm8a_:

Click to download the PDB-style file with coordinates for d1tm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1tm8a_: