![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (2 families) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
![]() | Protein automated matches [191175] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225041] (2 PDB entries) |
![]() | Domain d1tm8a_: 1tm8 A: [344522] automated match to d1ymga1 complexed with bng |
PDB Entry: 1tm8 (more details), 2.24 Å
SCOPe Domain Sequences for d1tm8a_:
Sequence, based on SEQRES records: (download)
>d1tm8a_ f.19.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavghisga hvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgv svgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnp arsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
>d1tm8a_ f.19.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg
Timeline for d1tm8a_: