Lineage for d1t3oa1 (1t3o A:1-74)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412587Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2412588Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2412627Family b.151.1.0: automated matches [321708] (1 protein)
    not a true family
  6. 2412628Protein automated matches [321709] (2 species)
    not a true protein
  7. 2412629Species Bacillus subtilis [TaxId:1423] [346268] (1 PDB entry)
  8. 2412630Domain d1t3oa1: 1t3o A:1-74 [344520]
    Other proteins in same PDB: d1t3oa2
    automated match to d5dmbd_

Details for d1t3oa1

PDB Entry: 1t3o (more details)

PDB Description: Solution structure of CsrA, a bacterial carbon storage regulatory protein
PDB Compounds: (A:) Carbon storage regulator

SCOPe Domain Sequences for d1t3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3oa1 b.151.1.0 (A:1-74) automated matches {Bacillus subtilis [TaxId: 1423]}
mlvlsrkineaiqigadievkviavegdqvklgidapkhidihrkeiyltiqeennraaa
lssdvisalssqkk

SCOPe Domain Coordinates for d1t3oa1:

Click to download the PDB-style file with coordinates for d1t3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1t3oa1:

  • d1t3oa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3oa2