Lineage for d1s6tb_ (1s6t B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866487Protein Heparan sulfate 3-O-sulfotransferase [102354] (1 species)
  7. 2866488Species Mouse (Mus musculus) [TaxId:10090] [102355] (2 PDB entries)
    Uniprot O35310 48-311
  8. 2866490Domain d1s6tb_: 1s6t B: [344517]
    automated match to d1vkja_
    complexed with pap, so4

Details for d1s6tb_

PDB Entry: 1s6t (more details), 2.5 Å

PDB Description: Crystal structure of heparan sulfate 3-O-sulfotransferase isoform 1 in the presence of PAP
PDB Compounds: (B:) heparan sulfate (glucosamine) 3-O-sulfotransferase 1

SCOPe Domain Sequences for d1s6tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s6tb_ c.37.1.5 (B:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]}
stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
hepnkkffklvgrtfdwh

SCOPe Domain Coordinates for d1s6tb_:

Click to download the PDB-style file with coordinates for d1s6tb_.
(The format of our PDB-style files is described here.)

Timeline for d1s6tb_: