Lineage for d6bd9a3 (6bd9 A:461-648)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473068Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 2473069Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)
  7. 2473070Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2473073Domain d6bd9a3: 6bd9 A:461-648 [344491]
    Other proteins in same PDB: d6bd9a1, d6bd9a2, d6bd9b1, d6bd9b2
    complexed with fad, k, mg, oxy, po4, pyr, tpp

Details for d6bd9a3

PDB Entry: 6bd9 (more details), 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (A:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d6bd9a3:

Sequence, based on SEQRES records: (download)

>d6bd9a3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkk

Sequence, based on observed residues (ATOM records): (download)

>d6bd9a3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnnees
hthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk

SCOPe Domain Coordinates for d6bd9a3:

Click to download the PDB-style file with coordinates for d6bd9a3.
(The format of our PDB-style files is described here.)

Timeline for d6bd9a3: