![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (243 species) not a true protein |
![]() | Species Naegleria fowleri [TaxId:5763] [338422] (2 PDB entries) |
![]() | Domain d6aqye1: 6aqy E:2-333 [344481] Other proteins in same PDB: d6aqya2, d6aqye2 automated match to d6aqzb_ complexed with cl, so4 |
PDB Entry: 6aqy (more details), 2.55 Å
SCOPe Domain Sequences for d6aqye1:
Sequence, based on SEQRES records: (download)
>d6aqye1 c.2.1.0 (E:2-333) automated matches {Naegleria fowleri [TaxId: 5763]} aqrevsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadac kqpfekyrptyvihlaafvgglfknmnfkvsfwldnvnmnnniltccydfgvkktiscls tcvfpdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsvi ptnlfgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllw tmfnyqseepimlcvseedeksigqvaqtikdafnftgnmvfdtskadgqykktssnakf lrlnptfqytpfeqaiketvqwflenyetark
>d6aqye1 c.2.1.0 (E:2-333) automated matches {Naegleria fowleri [TaxId: 5763]} aqrevsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadac kqpfekyrptyvihlaafvgnmnfkvsfwldnvnmnnniltccydfgvkktisclstcvf pdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsviptnl fgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllwtmfn yqseepimlcvseedeksigqvaqtikdafnftgnmvfdtskadgqykktssnakflrln ptfqytpfeqaiketvqwflenyetark
Timeline for d6aqye1: