Lineage for d6ankb2 (6ank B:266-403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773134Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)
  8. 2773149Domain d6ankb2: 6ank B:266-403 [344477]
    automated match to d6anka2
    complexed with ca, edo

Details for d6ankb2

PDB Entry: 6ank (more details), 2.25 Å

PDB Description: synaptotagmin-7, c2a- and c2b-domains
PDB Compounds: (B:) Synaptotagmin-7

SCOPe Domain Sequences for d6ankb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ankb2 b.7.1.0 (B:266-403) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
srgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekkktvtk
krnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpgevkhwk
dmiarprqpvaqwhqlka

SCOPe Domain Coordinates for d6ankb2:

Click to download the PDB-style file with coordinates for d6ankb2.
(The format of our PDB-style files is described here.)

Timeline for d6ankb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ankb1