![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (4 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries) |
![]() | Domain d6ankb2: 6ank B:266-403 [344477] automated match to d6anka2 complexed with ca, edo |
PDB Entry: 6ank (more details), 2.25 Å
SCOPe Domain Sequences for d6ankb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ankb2 b.7.1.0 (B:266-403) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} srgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekkktvtk krnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpgevkhwk dmiarprqpvaqwhqlka
Timeline for d6ankb2: