| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
| Protein automated matches [190497] (4 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries) |
| Domain d6ankb1: 6ank B:135-259 [344476] automated match to d6anka1 complexed with ca, edo |
PDB Entry: 6ank (more details), 2.25 Å
SCOPe Domain Sequences for d6ankb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ankb1 b.7.1.0 (B:135-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpfvkiyllpdkkhkletkvkrk
nlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnkvdltqmqtfw
kdlkp
Timeline for d6ankb1: