Lineage for d5y5pa_ (5y5p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818524Species White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId:654913] [342590] (3 PDB entries)
  8. 2818528Domain d5y5pa_: 5y5p A: [344469]
    automated match to d5y5pe_
    complexed with dur, mg, pop

Details for d5y5pa_

PDB Entry: 5y5p (more details), 2.03 Å

PDB Description: crystal structure of the dutpase of white spot syndrome virus in complex with du,ppi and mg2+
PDB Compounds: (A:) Wsv112

SCOPe Domain Sequences for d5y5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5pa_ b.85.4.0 (A:) automated matches {White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId: 654913]}
dssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfp
dgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlif
lrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn

SCOPe Domain Coordinates for d5y5pa_:

Click to download the PDB-style file with coordinates for d5y5pa_.
(The format of our PDB-style files is described here.)

Timeline for d5y5pa_: