Lineage for d5xnlz_ (5xnl Z:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577485Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2577512Family f.17.5.0: automated matches [345984] (1 protein)
    not a true family
  6. 2577513Protein automated matches [346122] (1 species)
    not a true protein
  7. 2577514Species Pea (Pisum sativum) [TaxId:3888] [346422] (1 PDB entry)
  8. 2577515Domain d5xnlz_: 5xnl Z: [344468]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_
    automated match to d5h2fz_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlz_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5xnlz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlz_ f.17.5.0 (Z:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mtiafqlavfalivtssillisvpvvfaspdgwssnknvvfsgtslwiglvflvgilnsl
is

SCOPe Domain Coordinates for d5xnlz_:

Click to download the PDB-style file with coordinates for d5xnlz_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlz_:

  • d5xnlz_ is new in SCOPe 2.07-stable