SCOPe 2.08: Domain d5xnlz_: 5xnl Z:

Lineage for d5xnlz_ (5xnl Z:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.5: PsbZ-like [161055] (2 families)
   automatically mapped to Pfam PF01737

5. Family f.17.5.0: automated matches [345984] (1 protein)
   not a true family

6. Protein automated matches [346122] (2 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [346422] (1 PDB entry)

8. Domain d5xnlz_: 5xnl Z: [344468]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_
   automated match to d5h2fz_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlz_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5xnlz_:

Sequence; same for both SEQRES and ATOM records:

>d5xnlz_ f.17.5.0 (Z:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mtiafqlavfalivtssillisvpvvfaspdgwssnknvvfsgtslwiglvflvgilnsl
is

Timeline for d5xnlz_:

• d5xnlz_ first appeared in SCOPe 2.07