Lineage for d5xnls_ (5xnl S:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580604Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2580605Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2580637Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2580638Protein automated matches [276200] (2 species)
    not a true protein
  7. 2580639Species Pea (Pisum sativum) [TaxId:3888] [276203] (5 PDB entries)
  8. 2580644Domain d5xnls_: 5xnl S: [344466]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnly_, d5xnlz_
    automated match to d4lcza_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnls_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (S:) Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26

SCOPe Domain Sequences for d5xnls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnls_ f.43.1.0 (S:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
vddelakwygpdrriflpeglldrseipayltgevpgdygydpfglskkpddfakyqaye
lihgrwamlgaagfiipeafnkfgancgpeavwfktgallldgntlnyfgknipinlifa
viaevvlvggaeyyriinglnledklhpggpfdplglakdpdqaailkvkeikngrlamf
amlgffiqayvtgegpvenlakhlsdpfannlltvlag

SCOPe Domain Coordinates for d5xnls_:

Click to download the PDB-style file with coordinates for d5xnls_.
(The format of our PDB-style files is described here.)

Timeline for d5xnls_:

  • d5xnls_ is new in SCOPe 2.07-stable