SCOPe 2.08: Domain d5xnls_: 5xnl S:

Lineage for d5xnls_ (5xnl S:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d5xnls_: 5xnl S: [344466]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnly_, d5xnlz_
   automated match to d4lcza_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnls_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (S:) Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26

SCOPe Domain Sequences for d5xnls_:

Sequence; same for both SEQRES and ATOM records:

>d5xnls_ f.43.1.0 (S:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
vddelakwygpdrriflpeglldrseipayltgevpgdygydpfglskkpddfakyqaye
lihgrwamlgaagfiipeafnkfgancgpeavwfktgallldgntlnyfgknipinlifa
viaevvlvggaeyyriinglnledklhpggpfdplglakdpdqaailkvkeikngrlamf
amlgffiqayvtgegpvenlakhlsdpfannlltvlag

Timeline for d5xnls_:

• d5xnls_ first appeared in SCOPe 2.07