Lineage for d5xnlp_ (5xnl P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968341Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2968342Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2968348Family d.107.1.2: PsbP-like [111092] (2 proteins)
    Pfam PF01789
  6. 2968353Protein automated matches [196539] (3 species)
    not a true protein
  7. 2968357Species Pea (Pisum sativum) [TaxId:3888] [346373] (1 PDB entry)
  8. 2968358Domain d5xnlp_: 5xnl P: [344465]
    Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnls_, d5xnly_, d5xnlz_
    automated match to d4rtia_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlp_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (P:) Oxygen-evolving enhancer protein 2, chloroplastic

SCOPe Domain Sequences for d5xnlp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnlp_ d.107.1.2 (P:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
aygeaanvfgkaktntdylpyngdgfkllvpakwnpskerefpgqvlryednfdatsnvs
vlvqttdkksitdygspeeflskvdyllgkqaffgqtdseggfdtnavavanilessapv
iggkqyynisvltrtadgdeggkhqlitatvkdgklyickaqagdkrwfkgarkfvedta
ssfsva

SCOPe Domain Coordinates for d5xnlp_:

Click to download the PDB-style file with coordinates for d5xnlp_.
(The format of our PDB-style files is described here.)

Timeline for d5xnlp_: