SCOPe 2.08: Domain d5xnlm_: 5xnl M:

Lineage for d5xnlm_ (5xnl M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein automated matches [196649] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [346424] (1 PDB entry)

8. Domain d5xnlm_: 5xnl M: [344463]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
   automated match to d3a0hm_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlm_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5xnlm_:

Sequence; same for both SEQRES and ATOM records:

>d5xnlm_ f.23.35.1 (M:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mevnilafiatalfilvptaflliiyvktvsqs

Timeline for d5xnlm_:

• d5xnlm_ first appeared in SCOPe 2.07