SCOPe 2.08: Domain d5xnlh_: 5xnl H:

Lineage for d5xnlh_ (5xnl H:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein automated matches [191001] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [346423] (1 PDB entry)

8. Domain d5xnlh_: 5xnl H: [344462]
   Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlk_, d5xnlm_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_
   automated match to d5h2fh_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnlh_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5xnlh_:

Sequence; same for both SEQRES and ATOM records:

>d5xnlh_ f.23.33.1 (H:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gprrtavgdllkplnseygkvapgwgttplmgiamalfavflsiileiynssllldqism

Timeline for d5xnlh_:

• d5xnlh_ first appeared in SCOPe 2.07