SCOPe 2.08: Domain d5xnl5_: 5xnl 5:

Lineage for d5xnl5_ (5xnl 5:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)

6. Protein automated matches [190507] (3 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries)

8. Domain d5xnl5_: 5xnl 5: [344457]
   Other proteins in same PDB: d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnlo_, d5xnlp_, d5xnls_, d5xnlz_
   automated match to d2bhwa_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnl5_

PDB Entry: 5xnl, 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum

PDB Compounds: (5:) Chlorophyll a-b binding protein 8, chloroplastic

SCOPe Domain Sequences for d5xnl5_:

Sequence; same for both SEQRES and ATOM records:

>d5xnl5_ f.43.1.1 (5:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gspwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfsknrelevihsrwa
mlgalgcvfpellsrngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwatqv
ilmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkelkngrlamfsmf
gffvqaivtgkgplenladhlsdpvnnnawsyatnfvpg

Timeline for d5xnl5_:

• d5xnl5_ first appeared in SCOPe 2.07