Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
Domain d5xjec2: 5xje C:10-86 [344452] Other proteins in same PDB: d5xjea1, d5xjea2, d5xjeb1, d5xjeb2 complexed with cl |
PDB Entry: 5xje (more details), 2.4 Å
SCOPe Domain Sequences for d5xjec2:
Sequence, based on SEQRES records: (download)
>d5xjec2 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} vflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvddsgey rcqtqlstlsdpvqlev
>d5xjec2 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} vflepqwyrvlekdsvtlkcqwfhneslissqyfidaatvddsgeyrcqtstlsdpvqle v
Timeline for d5xjec2:
View in 3D Domains from other chains: (mouse over for more information) d5xjea1, d5xjea2, d5xjeb1, d5xjeb2 |