SCOPe 2.08: Domain d5xjec2: 5xje C:10-86

Lineage for d5xjec2 (5xje C:10-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
   Uniprot O75015 23-189

8. Domain d5xjec2: 5xje C:10-86 [344452]
   Other proteins in same PDB: d5xjea1, d5xjea2, d5xjeb1, d5xjeb2
   complexed with cl

Details for d5xjec2

PDB Entry: 5xje, 2.4 Å

PDB Description: crystal structure of fucosylated igg1 fc complexed with bis- glycosylated soluble form of fc gamma receptor iiia

PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5xjec2:

Sequence, based on SEQRES records:

>d5xjec2 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvddsgey
rcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records):

>d5xjec2 b.1.1.4 (C:10-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
vflepqwyrvlekdsvtlkcqwfhneslissqyfidaatvddsgeyrcqtstlsdpvqle
v

Timeline for d5xjec2:

• d5xjec2 first appeared in SCOPe 2.07