Lineage for d5ws5u_ (5ws5 U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2325087Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2325322Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 2325323Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2325327Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (10 PDB entries)
  8. 2325334Domain d5ws5u_: 5ws5 U: [344430]
    Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5v_, d5ws5x_, d5ws5z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5u_

PDB Entry: 5ws5 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5ws5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws5u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5ws5u_:

Click to download the PDB-style file with coordinates for d5ws5u_.
(The format of our PDB-style files is described here.)

Timeline for d5ws5u_:

  • d5ws5u_ is new in SCOPe 2.07-stable