SCOPe 2.07: Domain d5ws5m1: 5ws5 M:2-33

Lineage for d5ws5m1 (5ws5 M:2-33)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)

8. Domain d5ws5m1: 5ws5 M:2-33 [344427]
   Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5u_, d5ws5v_, d5ws5x_, d5ws5z_
   automated match to d2axtm1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5m1

PDB Entry: 5ws5, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)

PDB Compounds: (M:) Photosystem II protein M

SCOPe Domain Sequences for d5ws5m1:

Sequence; same for both SEQRES and ATOM records:

>d5ws5m1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
evnqlgliatalfvlvpsvfliilyvqtesqq

Timeline for d5ws5m1:

• d5ws5m1 is new in SCOPe 2.07-stable
  
• d5ws5m1 appears in the current release, SCOPe 2.08