SCOPe 2.08: Domain d5u6na_: 5u6n A:

Lineage for d5u6na_ (5u6n A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (40 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256209] (9 PDB entries)

8. Domain d5u6na_: 5u6n A: [344415]
   automated match to d5u6nb_
   complexed with bgc, gln, sal, udp

Details for d5u6na_

PDB Entry: 5u6n, 2 Å

PDB Description: crystal structure of udp-glucosyltransferase, ugt74f2 (t15s), with udp and salicylic acid

PDB Compounds: (A:) UDP-glycosyltransferase 74F2

SCOPe Domain Sequences for d5u6na_:

Sequence; same for both SEQRES and ATOM records:

>d5u6na_ c.87.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rghvlavpypsqghitpfrqfckrlhfkglkttlalttfvfnsinpdlsgpisiatisdg
ydhggfetadsiddylkdfktsgsktiadiiqkhqtsdnpitcivydaflpwaldvaref
glvatpfftqpcavnyvyylsyinngslqlpieelpflelqdlpsffsvsgsypayfemv
lqqfinfekadfvlvnsfqelelhenelwskacpvltigptipsiyldqriksdtgydln
lfeskddsfcinwldtrpqgsvvyvafgsmaqltnvqmeelasavsnfsflwvvrsseee
klpsgfletvnkekslvlkwspqlqvlsnkaigcflthcgwnstmealtfgvpmvampqw
tdqpmnakyiqdvwkagvrvktekesgiakreeiefsikevmegerskemkknvkkwrdl
avkslneggstdtnidtfvsrv

Timeline for d5u6na_:

• d5u6na_ first appeared in SCOPe 2.07