Lineage for d5u4pb_ (5u4p B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2490288Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2490289Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2490314Protein Proteasome regulatory subunit Rpn11 [346088] (1 species)
  7. 2490315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346338] (5 PDB entries)
  8. 2490319Domain d5u4pb_: 5u4p B: [344413]
    Other proteins in same PDB: d5u4pa_, d5u4pc_
    automated match to d5w83b_
    complexed with zn

Details for d5u4pb_

PDB Entry: 5u4p (more details), 2.5 Å

PDB Description: protein-protein complex between 26s proteasome regulatory subunit rpn8, rpn11, and ubiquitin s31
PDB Compounds: (B:) 26s proteasome regulatory subunit rpn11

SCOPe Domain Sequences for d5u4pb_:

Sequence, based on SEQRES records: (download)

>d5u4pb_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsveav
ddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdp
iqsvkgkvvidafrlidtgalinnleprqttsntgllnkaniqalihglnrhyyslnidy
hktaketkmlmnlh

Sequence, based on observed residues (ATOM records): (download)

>d5u4pb_ c.97.3.1 (B:) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsveav
ddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdp
iqsvkgkvvidafrlirhyyslnidyhtaketkmlmnlh

SCOPe Domain Coordinates for d5u4pb_:

Click to download the PDB-style file with coordinates for d5u4pb_.
(The format of our PDB-style files is described here.)

Timeline for d5u4pb_:

  • d5u4pb_ is new in SCOPe 2.07-stable