Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries) |
Domain d5u1af_: 5u1a F: [344408] automated match to d5u1aa_ complexed with cl, fe, gol, na |
PDB Entry: 5u1a (more details), 2 Å
SCOPe Domain Sequences for d5u1af_:
Sequence, based on SEQRES records: (download)
>d5u1af_ a.25.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 210]} mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr k
>d5u1af_ a.25.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 210]} mlskdiikllneqvnkemnssnlymsmsswcytgsysldgcgtflfdhaaeeyehakkli vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d5u1af_: