Lineage for d5u1af_ (5u1a F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704076Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries)
  8. 2704082Domain d5u1af_: 5u1a F: [344408]
    automated match to d5u1aa_
    complexed with cl, fe, gol, na

Details for d5u1af_

PDB Entry: 5u1a (more details), 2 Å

PDB Description: ferritin with gc mtre loop 1 inserted at his34
PDB Compounds: (F:) Ferritin,MtrE protein chimera

SCOPe Domain Sequences for d5u1af_:

Sequence, based on SEQRES records: (download)

>d5u1af_ a.25.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
k

Sequence, based on observed residues (ATOM records): (download)

>d5u1af_ a.25.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgsysldgcgtflfdhaaeeyehakkli
vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn
flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d5u1af_:

Click to download the PDB-style file with coordinates for d5u1af_.
(The format of our PDB-style files is described here.)

Timeline for d5u1af_: