Lineage for d5u1ac_ (5u1a C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (42 species)
    not a true protein
  7. 2314756Species Helicobacter pylori [TaxId:210] [340097] (2 PDB entries)
  8. 2314759Domain d5u1ac_: 5u1a C: [344406]
    automated match to d5u1aa_
    complexed with cl, fe, gol, na

Details for d5u1ac_

PDB Entry: 5u1a (more details), 2 Å

PDB Description: ferritin with gc mtre loop 1 inserted at his34
PDB Compounds: (C:) Ferritin,MtrE protein chimera

SCOPe Domain Sequences for d5u1ac_:

Sequence, based on SEQRES records: (download)

>d5u1ac_ a.25.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
ks

Sequence, based on observed residues (ATOM records): (download)

>d5u1ac_ a.25.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcytgysldgcgtflfdhaaeeyehakkliv
flnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnf
lqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrks

SCOPe Domain Coordinates for d5u1ac_:

Click to download the PDB-style file with coordinates for d5u1ac_.
(The format of our PDB-style files is described here.)

Timeline for d5u1ac_:

  • d5u1ac_ is new in SCOPe 2.07-stable