| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
| Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
| Protein automated matches [190891] (38 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [335395] (6 PDB entries) |
| Domain d5t3oc2: 5t3o C:161-310 [344400] complexed with adp, so4 |
PDB Entry: 5t3o (more details), 2.2 Å
SCOPe Domain Sequences for d5t3oc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t3oc2 c.61.1.0 (C:161-310) automated matches {Thermus thermophilus [TaxId: 274]}
dlenavvvapdagdlkrasalarrlglplafidkervsdtevrvrmlvgevegktalivd
deistagslveavealmqagakevyaaathgvyvgpaldriakspvkevaatdtcppkeg
pklrtltvaplfaeaiwrihrgesvsslft
Timeline for d5t3oc2:
View in 3DDomains from other chains: (mouse over for more information) d5t3oa1, d5t3oa2, d5t3ob1, d5t3ob2 |