SCOPe 2.08: Domain d5sx4l2: 5sx4 L:107-213

Lineage for d5sx4l2 (5sx4 L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5sx4l2: 5sx4 L:107-213 [344396]
   Other proteins in same PDB: d5sx4h1, d5sx4h2, d5sx4i1, d5sx4j1, d5sx4j2, d5sx4l1, d5sx4m1, d5sx4m2, d5sx4m3, d5sx4n1, d5sx4n2, d5sx4n3
   automated match to d1dn0a2
   complexed with 1pe, edo, gol, so4

Details for d5sx4l2

PDB Entry: 5sx4, 2.8 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3.

PDB Compounds: (L:) Panitumumab Fab Light Chain

SCOPe Domain Sequences for d5sx4l2:

Sequence; same for both SEQRES and ATOM records:

>d5sx4l2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5sx4l2:

• d5sx4l2 first appeared in SCOPe 2.07