Lineage for d5o7af2 (5o7a F:77-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978888Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2978889Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2978890Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries)
  8. 2979024Domain d5o7af2: 5o7a F:77-378 [344387]
    Other proteins in same PDB: d5o7aa1, d5o7aa2, d5o7ab1, d5o7ab2, d5o7ac1, d5o7ac2, d5o7ad1, d5o7ad2, d5o7ae_, d5o7af1
    complexed with 9n5, acp, gdp, gtp, mg

Details for d5o7af2

PDB Entry: 5o7a (more details), 2.5 Å

PDB Description: quinolin-6-yloxyacetamides are microtubule destabilizing agents that bind to the colchicine site of tubulin
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5o7af2:

Sequence, based on SEQRES records: (download)

>d5o7af2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5o7af2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelctwfpesyvwiylekplllepghkfdirswvlvdhlyniylyregvlrl
tnhciqeegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyq
sfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplasifikl

SCOPe Domain Coordinates for d5o7af2:

Click to download the PDB-style file with coordinates for d5o7af2.
(The format of our PDB-style files is described here.)

Timeline for d5o7af2: