SCOPe 2.08: Domain d5o7af2: 5o7a F:77-378

Lineage for d5o7af2 (5o7a F:77-378)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
   Pfam PF03133; PubMed 22020298

6. Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries)

8. Domain d5o7af2: 5o7a F:77-378 [344387]
   Other proteins in same PDB: d5o7aa1, d5o7aa2, d5o7ab1, d5o7ab2, d5o7ac1, d5o7ac2, d5o7ad1, d5o7ad2, d5o7ae_, d5o7af1
   complexed with 9n5, acp, gdp, gtp, mg

Details for d5o7af2

PDB Entry: 5o7a, 2.5 Å

PDB Description: quinolin-6-yloxyacetamides are microtubule destabilizing agents that bind to the colchicine site of tubulin

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5o7af2:

Sequence, based on SEQRES records:

>d5o7af2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records):

>d5o7af2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelctwfpesyvwiylekplllepghkfdirswvlvdhlyniylyregvlrl
tnhciqeegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyq
sfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplasifikl

Timeline for d5o7af2:

• d5o7af2 first appeared in SCOPe 2.07