Lineage for d5n4fa2 (5n4f A:7-455)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399593Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2399594Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2399595Protein Prolyl oligopeptidase, N-terminal domain [50995] (2 species)
  7. 2399596Species Galerina marginata [TaxId:109633] [346262] (1 PDB entry)
  8. 2399597Domain d5n4fa2: 5n4f A:7-455 [344375]
    Other proteins in same PDB: d5n4fa1
    complexed with gol

Details for d5n4fa2

PDB Entry: 5n4f (more details), 2.4 Å

PDB Description: prolyl oligopeptidase b from galerina marginata - apo protein
PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d5n4fa2:

Sequence, based on SEQRES records: (download)

>d5n4fa2 b.69.7.1 (A:7-455) Prolyl oligopeptidase, N-terminal domain {Galerina marginata [TaxId: 109633]}
apgnypstrrsdhvdtyqsaskgevpvpdpyqwleestdevdkwttaqadlaqsyldqna
diqklaekfrasrnyakfsaptllddghwywfynrglqsqsvlyrskepalpdfskgddn
vgdvffdpnvlaadgsagmvlckfspdgkffayavshlggdystiyvrstssplsqasva
qgvdgrlsdevkwfkfstiiwtkdskgflyqryparerhegtrsdrnammcyhkvgttqe
ediivyqdnehpewiygadtsedgkylylyqfkdtskknllwvaeldedgvksgihwrkv
vneyaadyniitnhgslvyiktnlnapqykvitidlskdepeirdfipeekdaklaqvnc
aneeyfvaiykrnvkdeiylyskagvqltrlapdfvgaasianrqkqthffltlsgfntp
gtiarydftapetqrfsilrttkvneldp

Sequence, based on observed residues (ATOM records): (download)

>d5n4fa2 b.69.7.1 (A:7-455) Prolyl oligopeptidase, N-terminal domain {Galerina marginata [TaxId: 109633]}
apgnypstrrsdhvdtyqsaskgevpvpdpyqwleestdevdkwttaqadlaqsyldqna
diqklaekfrasrnyakfsaptllddghwywfynrglqsqsvlyrskepalpdfskgddn
vgdvffdpnvlaadgsagmvlckfspdgkffayavshlggdystiyvrstssplsqasva
qgvdgrlsdevkwfkfstiiwtkdskgflyqryparsdrnammcyhkvgttqeediivyq
dnehpewiygadtsedgkylylyqfkdtskknllwvaeldgvksgihwrkvvneyaadyn
iitnhgslvyiktnlnapqykvitidlskdepeirdfipeekdaklaqvncaneeyfvai
ykrnvkdeiylyskagvqltrlapdfvgaasianrqkqthffltlsgfntpgtiarydft
apetqrfsilrttkvneldp

SCOPe Domain Coordinates for d5n4fa2:

Click to download the PDB-style file with coordinates for d5n4fa2.
(The format of our PDB-style files is described here.)

Timeline for d5n4fa2:

  • d5n4fa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5n4fa1