SCOPe 2.08: Domain d5mvga2: 5mvg A:10-107

Lineage for d5mvga2 (5mvg A:10-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5mvga2: 5mvg A:10-107 [344367]
   Other proteins in same PDB: d5mvga1, d5mvgb2
   complexed with gol

Details for d5mvga2

PDB Entry: 5mvg, 2.2 Å

PDB Description: crystal structure of non-amyloidogenic light chain dimer m7

PDB Compounds: (A:) light chain dimer

SCOPe Domain Sequences for d5mvga2:

Sequence, based on SEQRES records:

>d5mvga2 b.1.1.0 (A:10-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvalgqtvkitcqgdslrmyyaswyqqkpaqapvlviyaeknrpsgipdrfsasssgst
asltitgaqaedeadyycnsrdnsgdhlvfgggtkltv

Sequence, based on observed residues (ATOM records):

>d5mvga2 b.1.1.0 (A:10-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsvalgqtvkitcqgdslrmywyqqkpaqapvlyaeknrpsgipdrasltitgaqaedea
dyycfgggtkltv

Timeline for d5mvga2:

• d5mvga2 first appeared in SCOPe 2.07