SCOPe 2.08: Domain d5mlkb3: 5mlk B:125-339

Lineage for d5mlkb3 (5mlk B:125-339)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [330748] (1 PDB entry)

8. Domain d5mlkb3: 5mlk B:125-339 [344366]
   Other proteins in same PDB: d5mlka1, d5mlka3, d5mlkb1, d5mlkb2

Details for d5mlkb3

PDB Entry: 5mlk, 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)

PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlkb3:

Sequence, based on SEQRES records:

>d5mlkb3 d.142.1.0 (B:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpgtpdpvkgadevvafaeeyglpiaikaahggggkgmkvarti
deipelyesavreataafgrgecyveryldkprhveaqviadqhgnvvvagtrdcslqrr
yqklveeapapfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlq
vehpvteetagidlvlqqfriangeklditedptp

Sequence, based on observed residues (ATOM records):

>d5mlkb3 d.142.1.0 (B:125-339) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dkvtarhiaaraqaplvpyldkprhveaqviadqhgnvvvagtrdcslqrryqklveeap
apfltdfqrkeihdsakrickeahyhgagtveylvgqdglisflevntrlqvehpvteet
agidlvlqqfriangeklditedptp

Timeline for d5mlkb3:

• d5mlkb3 first appeared in SCOPe 2.07