Lineage for d5macd2 (5mac D:140-473)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838580Species Methanococcoides burtonii [TaxId:29291] [346274] (1 PDB entry)
  8. 2838584Domain d5macd2: 5mac D:140-473 [344364]
    Other proteins in same PDB: d5maca1, d5macb1, d5macc1, d5macd1, d5mace1
    complexed with cap, cl, mg

Details for d5macd2

PDB Entry: 5mac (more details), 2.6 Å

PDB Description: crystal structure of decameric methanococcoides burtonii rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (D:) Ribulose-1,5-bisphosphate carboxylase-oxygenase type III

SCOPe Domain Sequences for d5macd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5macd2 c.1.14.1 (D:140-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Methanococcoides burtonii [TaxId: 29291]}
ydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaevcydfwvgggdfvkndepqa
nqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfdtmiercemitnagfepgsy
aflidgitagwmavqtlrrrypdvflhfhraahgaftrqenpigfsvlvlskfarlagas
gihtgtagigkmkgtpaedvvaahsiqylkspghffeqtwskimdtdkdvinlvnedlah
hvileddswramkkccpivsgglnpvklkpfidvmenvdfittmgsgvhshpggtqsgak
alvqacdaylqgmdieeyakdhkelaeaiefyln

SCOPe Domain Coordinates for d5macd2:

Click to download the PDB-style file with coordinates for d5macd2.
(The format of our PDB-style files is described here.)

Timeline for d5macd2: