SCOPe 2.08: Domain d1elub_: 1elu B:

Lineage for d1elub_ (1elu B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein Cystine C-S lyase C-des [53415] (1 species)

7. Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)

8. Domain d1elub_: 1elu B: [34435]
   complexed with css, k, pda

Details for d1elub_

PDB Entry: 1elu, 1.55 Å

PDB Description: complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide.

PDB Compounds: (B:) l-cysteine/l-cystine c-s lyase

SCOPe Domain Sequences for d1elub_:

Sequence; same for both SEQRES and ATOM records:

>d1elub_ c.67.1.3 (B:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]}
qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
hyitdeeeinhllarladfgp

Timeline for d1elub_:

• d1elub_ first appeared (with stable ids) in SCOP 1.55
  
• d1elub_ appears in SCOPe 2.07