Lineage for d5lovf3 (5lov F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (79 PDB entries)
  8. 2541757Domain d5lovf3: 5lov F:77-378 [344345]
    Other proteins in same PDB: d5lova1, d5lova2, d5lovb1, d5lovb2, d5lovc1, d5lovc2, d5lovd1, d5lovd2, d5love_, d5lovf1, d5lovf2
    complexed with 71e, acp, ca, gdp, gtp, mes, mg

Details for d5lovf3

PDB Entry: 5lov (more details), 2.4 Å

PDB Description: dz-2384 tubulin complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5lovf3:

Sequence, based on SEQRES records: (download)

>d5lovf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5lovf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviypttderevflaaynrgnvwiaisseaselldviqk
ylekplllepghrkfdirswvlvdhlyniylyregvlrtpynsanygeegnemffeefnq
ylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwl
ievngapacaqklyaelcqgivdvaissvfplatsifikl

SCOPe Domain Coordinates for d5lovf3:

Click to download the PDB-style file with coordinates for d5lovf3.
(The format of our PDB-style files is described here.)

Timeline for d5lovf3:

  • d5lovf3 is new in SCOPe 2.07-stable